PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI07G17070.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family HRT-like
Protein Properties Length: 621aa    MW: 68907.7 Da    PI: 9.6467
Description HRT-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI07G17070.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HRT-like58.79.2e-19310339130
         HRT-like   1 iCGviledGsvCkrqPvkgRKRCeeHKGmR 30 
                      +CGv+ledGs C ++Pv+gRKRCe HKG+R
  OMERI07G17070.1 310 VCGVMLEDGSSCLDPPVQGRKRCELHKGRR 339
                      7****************************9 PP

2HRT-like521.1e-16584613130
         HRT-like   1 iCGviledGsvCkrqPvkgRKRCeeHKGmR 30 
                      iCG++ +dGs+Ck+qP+ gRKRC  HKG+R
  OMERI07G17070.1 584 ICGARASDGSPCKNQPIAGRKRCTMHKGQR 613
                      8****************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004650.007573182IPR000305GIY-YIG nuclease superfamily
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:2000033Biological Processregulation of seed dormancy process
GO:0097100Molecular Functionsupercoiled DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 621 aa     Download sequence    Send to blast
MPAASAAVPA RLKREDYPRT KHDSLFSPWK VLVGPSDWED HAAGKEGVQR YRVLNLPENF  60
PGLYELGVAR ASDEGIRAAR RWNGSGGGVV VVYLGQADSV RARLQQYGRT GSHLDAGNPP  120
PSAGEAETNP RATRNGLFRE VFVRGYSLVF RCALMGNKQE AEKTEARLLR VFDYAWNKLQ  180
NGVLRREEIL IKLEQGAVNN RSSLLSRVRH FKQEMFREKA GIKISRNGSV DVSSGIMKYM  240
LPRIRTFVGF RPQLVNSGDN VDKEIGIRWK NTSEGNSYGK QARRSSEGYK VKRVDVIKRR  300
TIPEQDSNDV CGVMLEDGSS CLDPPVQGRK RCELHKGRRL GRITVNPKGS SHSYSCQVEI  360
PVVESISPLT ENESESDQAQ QTSELLSKFL PATVKESSRP RYSFEAKEMK TGEAPIENGK  420
HETSEVIDIC EAKKSDNSAC TNKVISVSKK CQLHNGCKAE QFVSSRVIDL LQNEEKVHSM  480
TGDKLSGEEI SHGKYQSQEN QPSGRMWFEL IKLQNSTSTL SSKGQGRQRR VTSDVATICE  540
ALTDNRCRET IPMAGRERCD AHEGIKVTDA SSVPFSGSSG WPSICGARAS DGSPCKNQPI  600
AGRKRCTMHK GQRACRTPSI D
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1027920.0AK102792.1 Oryza sativa Japonica Group cDNA clone:J033107P15, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015644815.10.0PREDICTED: uncharacterized protein LOC4343751
TrEMBLA0A0E0EDS00.0A0A0E0EDS0_9ORYZ; Uncharacterized protein
STRINGLOC_Os07g39800.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP79483443
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56780.18e-65effector of transcription2